Deglycase PH1704

PhP1 protein

Organism: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Monomeric molecular weight: 18.6 kDa

Oligomeric state: Hexamer

Total molecular weight: 111.6 kDa

UniProt: O59413 (1-166)

Sequence:

MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERGTITGKHGYSVKVDLTFDKVNPEEFD ALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSFPGIKDD MINAGVEWVDAEVVVDGNWVSSRVPADLYAWMREFVKLLK

The data displayed in this entry is that of hexameric Protease 1 without the addition of iohexol that act as X-ray contrast variation agents. Refer to the full entry zip archive that contains additional SAXS data and model fits in the presence of 92 to 618 mM iohexol.