DUF2285 domain-containing protein

6H-QseM protein

Organism: Mesorhizobium loti

Monomeric molecular weight: 11.0 kDa

Oligomeric state: Monomer

Total molecular weight: 11.0 kDa

UniProt: Q8KGS3 (2-83)

Sequence:

MRGSHHHHHHGSKRKVQDEVPWSDSLTAYDNEHFTIYMRLLDASADDASEDEMAQLVLGIDPMREPERARMAVRSHLDRANWMVTTGYKELFAR

Monomeric triple-helix protein that binds and inhibits both TraR and FseA transcriptional regulator proteins from Mesorhizobium Loti R7A. The protein has a hexahistidine tag fused to the N-terminus for purification.