Non-structural protein V (Y211A, Y212A, Y213A mutant)

HeV_PNT3(AAA) protein

Organism: Hendra virus (isolate Horse/Autralia/Hendra/1994)

Monomeric molecular weight: 14.9 kDa

Oligomeric state: Monomer

Total molecular weight: 14.9 kDa

UniProt: O55777 (200-310)

Sequence:

MSYYHHHHHHLESTSLYKKAGFTPTEEPPVIPEAAAGSGRRGDLSKSPPRGNVNLDSIKIYTSDDEDENQL EYEDEFAKSSSEVVIDTTPEDNDSINQEEVVGDPSDQGLEHPFPLGKFPEKEETPDVRRKDS

HeV_PNT33A: The PNT3 region of Hendra virus V protein where three tyrosines have been mutated to three alanines (Y211A, Y212A, Y213A). The protein construct is preceded by a stretch of 22 vector-encoded residues (MSYYHHHHHHLESTSLYKKAGF) encompassing a hexahistidine tag.