Septin-7 (C-terminal domain of SEPT7 fused to SUMO)

SUMO-SEPT7c protein

Organism: Homo sapiens

Monomeric molecular weight: 25.2 kDa

Oligomeric state: Monomer

Total molecular weight: 25.2 kDa

UniProt: Q16181 (335-437)

Sequence:

MGDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIFASLEHHHHHH

N-terminal Small Ubiquitin-like Modifier (SUMO) protein fused to the C-terminal domain of Septin-7. The construct used for SAXS also contains a C-terminal polyhistidine tag.