V2 variant of the low complexity domain of hnRNPA1

V2 protein

Organism: synthetic construct

Monomeric molecular weight: 13.1 kDa

Oligomeric state: Monomer

Total molecular weight: 13.1 kDa

Sequence:

GSGGYGSSQGGFFGGGDAGGNGDGSDFGGGYPSGSNQNSGGFSGYGNDSFQGSAGMFNGFKSASKFSNSGGYGGGGQGNNNGSGGGSSFRNRRRRSNYSGGGSGRGRRYGSNFGGMYGGRSGFGGNGPGRSGFGGSN

Protein designed by shuffling the amino acids in the sequence of the low complexity domain of hnRNPA1, to achieve different single-chain dimensions and phase separation propensity.