Heme acquisition protein HasAp

HasApf5 protein

Organism: Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

Monomeric molecular weight: 19.0 kDa

Oligomeric state: Dimer

Total molecular weight: 38.1 kDa

UniProt: Q4K5N8 (1-183)

Sequence:

GSMSISISYSATYGGNTVAQYLTDWSAYFGDVNHRPGEVVDGTNTGGFNPGPFDGTQYAIKSTASDAAFVADGNLHYTLFSNPSHTLWGSVDTISLGDTLAGGSGSNYNLVSQEVSFTNLGLNSLKEEGRAGEVHKVVYGLMSGDSSALAGEIDALLKAIDPSLSVNSTFDDLAAAGVAHVNPAA

HasApf5 incorporating iron(III)-tetraphenylporphyrin (TPP) with the phenyl ligand attached to the phenyl group of Fe-TPP via a planar amide bond (Fe-TPP-phen) formed via a dimer of Ni2+ ions. The molecular weight of the dimer containing Fe-TPP-phen was estimated to be 39.9 kDa.