E3 ubiquitin-protein ligase DTX3L

DTX3L protein

Organism: Homo sapiens

Monomeric molecular weight: 11.6 kDa

Oligomeric state: Tetramer

Total molecular weight: 46.3 kDa

UniProt: Q8TDB6 (101-200)

Sequence:

SMISSLTQSQAETPSGDMHQHEGHIPNAVDSCLQKIFLTVTADLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQDIERIHQFLSEQFLESEQKQQ

N-terminal domain of human DTX3L that is mainly responsible for the oligomerisation of the protein. The protein construct used for SAXS contains an additional two amino acids at the N-terminus (SM).