importin-beta-binding domain of importin subunit alpha-1 labelled with unnatural amino acid diBrK

Br-labelled IBB protein

Organism: Homo sapiens

Monomeric molecular weight: 8.5 kDa

Oligomeric state: Monomer

Total molecular weight: 8.5 kDa

UniProt: J3QLL0 (2-73)

Sequence:

SGSGTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQG

Br-labeled importin-beta-binding domain of importin alpha incorporating the unnatural amino acid diBrK (N-ε-3,5-dibromobenzyloxycarbonyl-L-lysine). The positions of the diBrK (*) in the protein sequence are: SGSG*TNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQ*G