Nucleoprotein (L223P, L227P, L230P)

N-protein LP mutant protein

Organism: Severe acute respiratory syndrome coronavirus 2

Monomeric molecular weight: 8.3 kDa

Oligomeric state: Monomer

Total molecular weight: 8.3 kDa

UniProt: P0DTC9 (176-245)

Sequence:

GPSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLPLDRPNQPESKMSGKGQQQQGQTWSHPQFEK

Strep(II)-tagged N-protein 176-245, L223P, L227P, L230P triple mutant. The protein construct used for SAXS contains an additional two amino acids at the N-terminus (GP) as well as the VWSHPQFEK C-terminal tag.