Chimeric construct between the third dsRBD of human ADAR1 and the second dsRBD of Xenopus Xlrbpa (chimeric construct, residues 708-801, i.e. Chimeric ADAR1-ds3/Xlrbpa-ds2)

ADAR1-ds3/Xlrbpa-ds2 protein

Organism: Homo sapiens / Xenopus laevis

Monomeric molecular weight: 12.8 kDa

Oligomeric state: Monomer

Total molecular weight: 12.8 kDa

UniProt: P55265 (708-801)

Sequence:

MGSSHHHHHHSSGLVPRGSHMMPNKVRKIGELVRYLNTNPVGGLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVETFVETGSGTSKQVAKRVAAEKLLRKFITENEKAER

Chimeric construct between the third dsRBD of human ADAR1 and the second dsRBD of Xenopus Xlrbpa (chimeric construct, residues 708-801, i.e. Chimeric ADAR1-ds3/Xlrbpa-ds2). N-terminal 6xHis-Tag