Probable conserved Mce associated membrane protein

Mam1A delta 106 protein

Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Monomeric molecular weight: 14.8 kDa

Oligomeric state: Tetramer

Total molecular weight: 59.2 kDa

UniProt: O07419 (107-213)

Sequence:

MKHHHHHHPMSDYDIPTTENLYFQGAMAPDAGAMSASMQKIIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK

Mam1A/Rv0175 delta 106 is N-terminally truncated construct which lacks the alpha1-helix. Protein, despite the removal of TM-helix, is not soluble and required C12E9 detergent to be solubilized. Tetrameric form was calculated with SEC-MALS.